Recombinant Human S100 calcium binding protein A14 (ab104642)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9HCY8
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGQCRSANAEDAQEFSDVERAIE TLIKN FHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGS CND SKLEFRSFWELIGEAAKSVKLERPVRGH
    • Molecular weight14 kDa including tags
    • Amino acids1 to 104
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104642 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • BCMP84
    • Protein S100-A14
    • S100 calcium binding protein A14
    • S100 calcium-binding protein A14
    • S100a14
    • S100A15
    • S10AE_HUMAN
    • S114
    see all
  • FunctionModulates P53/TP53 protein levels, and thereby plays a role in the regulation of cell survival and apoptosis. Depending on the context, it can promote cell proliferation or apoptosis. Plays a role in the regulation of cell migration by modulating the levels of MMP2, a matrix protease that is under transcriptional control of P53/TP53. Does not bind calcium.
  • Tissue specificityExpressed at highest levels in colon and at moderate levels in thymus, kidney, liver, small intestine, and lung. Low expression in heart and no expression is seen in brain, skeletal muscle, spleen, placenta and peripheral blood leukocytes.
  • Sequence similaritiesBelongs to the S-100 family.
    Contains 1 EF-hand domain.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human S100 calcium binding protein A14 images

  • 15% SDS-PAGE showing ab104642 at approximately 13.8kDa (3µg).

References for Recombinant Human S100 calcium binding protein A14 (ab104642)

ab104642 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104642.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"