Recombinant Human S100A11 protein (ab104643)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP31949
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMAKISSPTETERCIESLIAVFQKYAG KDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLD FSEFLNLIGGLAMACHDSFLKAVPSQKRT
    • Molecular weight14 kDa including tags
    • Amino acids1 to 105
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104643 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab104643 is purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 30% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Calgizzarin
    • Epididymis secretory protein Li 43
    • HEL S 43
    • Metastatic lymph node gene 70 protein
    • MLN 70
    • MLN70
    • Protein S100 A11
    • Protein S100-A11, N-terminally processed
    • Protein S100-C
    • Protein S100A11
    • Protein S100C
    • S100 A11
    • S100 calcium binding protein A11
    • S100 calcium-binding protein A11
    • S100 calcium-binding protein A11 (calgizzarin)
    • S100a11
    • S100C
    • S10AB_HUMAN
    see all
  • FunctionFacilitates the differentiation and the cornification of keratinocytes.
  • Sequence similaritiesBelongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Post-translational
    modifications
    Phosphorylation at Thr-10 by PRKCA significantly suppresses homodimerization and promotes association with NCL/nucleolin which induces nuclear translocation.
  • Cellular localizationCytoplasm. Nucleus.
  • Information by UniProt

Recombinant Human S100A11 protein images

  • 15% SDS-PAGE showing ab104643 at approximately 14.2kDa (3µg).

References for Recombinant Human S100A11 protein (ab104643)

ab104643 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104643.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"