Recombinant Human S100A16 protein (ab96014)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ96FQ6
    • SpeciesHuman
    • SequenceMKHHHHHHAS MSDCYTELEKAVIVLVENFYKYVSKYSLVK NKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYW TLIGGITGPIAKLIHEQEQQSSS
    • Molecular weight13 kDa including tags
    • Amino acids1 to 103
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab96014 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20mM Tris, 150mM Sodium chloride, pH 7.5

  • ReconstitutionReconstitute to a concentration of 0.5 mg/ml (200 µl).

General Info

  • Alternative names
    • 2300002L21Rik
    • AAG13
    • Aging associated gene 13 protein
    • Aging associated protein 13
    • Aging-associated gene 13 protein
    • AI325039
    • AI663996
    • DT1P1A7
    • MGC17528
    • Protein S100 A16
    • Protein S100-A16
    • Protein S100-F
    • Protein S100F
    • S100 calcium binding protein A16
    • S100 calcium-binding protein A16
    • S100A16
    • S100F
    • S10AG_HUMAN
    see all
  • FunctionCalcium-binding protein. Binds one calcium ion per monomer.
  • Sequence similaritiesBelongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Cellular localizationNucleus > nucleolus. Cytoplasm. Primarily nucleolar. Translocates from the nucleolus to the cytoplasm in response to an increase of intracellular calcium levels.
  • Information by UniProt

Recombinant Human S100A16 protein images

  • 14% SDS-PAGE separation of ab96014

    Lane 1: M.W. marker - 14, 21, 31, 45, 66, 97 kDa
    Lane 2: Reduced and heated sample, 5µg / lane
    Lane 3: Non-reduced and non-heated sample, 5µg / lane

References for Recombinant Human S100A16 protein (ab96014)

ab96014 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab96014.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"