Recombinant Human S100A3 protein (ab116969)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP33764
    • SpeciesHuman
    • SequenceMARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEF RECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCS Q
    • Molecular weight37 kDa including tags
    • Amino acids1 to 101

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116969 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Protein S 100E
    • Protein S-100E
    • Protein S100 A3
    • Protein S100-A3
    • S100 calcium binding protein A3
    • S100 calcium-binding protein A3
    • S100a3
    • S100E
    • S10A3_HUMAN
    see all
  • FunctionBinds both calcium and zinc. Probably binds 2 zinc ions per molecule. May be involved in calcium-dependent cuticle cell differentiation and hair shaft formation.
  • Tissue specificitySkin specific.
  • Sequence similaritiesBelongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Information by UniProt

Recombinant Human S100A3 protein images

  • 12.5% SDS-PAGE showing ab116969 at approximately 36.74kDa.
    Stained with Coomassie Blue.

References for Recombinant Human S100A3 protein (ab116969)

ab116969 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116969.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"