Recombinant Human S100A5 protein (ab104750)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP33763
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMETPLEKALTTMVTTFHKYSGREGSKLTLS RKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLC MAYNDFFLEDNK
    • Molecular weight13 kDa including tags
    • Amino acids1 to 92
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104750 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab104750 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 30% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, 0.1mM PMSF, pH 8.0

General Info

  • Alternative names
    • Protein S-100D
    • Protein S100-A5
    • S100 calcium binding protein A5
    • S100 calcium-binding protein A5
    • S100a5
    • S100D
    • S100D9
    • S10A5_HUMAN
    see all
  • FunctionBinds calcium, zinc and copper. One subunit can simultaneously bind 2 calcium ions or 2 copper ions plus 1 zinc ion. Calcium and copper ions compete for the same binding sites.
  • Sequence similaritiesBelongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Information by UniProt

Recombinant Human S100A5 protein images

  • 15% SDS-PAGE (3µg).

References for Recombinant Human S100A5 protein (ab104750)

ab104750 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104750.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"