Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKHHHHHHASTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPS LLKGPNTLDDLFQELDKNGDGEVSFEEFQVLVKKISQ
    • Molecular weight
      10 kDa including tags
    • Amino acids
      2 to 79
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab96001 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 50mM Sodium chloride, 20mM Tris, pH 7.5

  • Reconstitution
    Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely.

General Info

  • Alternative names
    • CABP
    • CABP 1
    • CABP1
    • CABP9K
    • CALB3
    • Calbindin D9k
    • Calbindin-D9k
    • intestinal
    • Protein S100-G
    • S100 calcium binding protein G
    • S100 calcium-binding protein G
    • S100G
    • S100G_HUMAN
    • Vitamin D-dependent calcium-binding protein
    see all
  • Sequence similarities
    Belongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Information by UniProt

Images

  • 14% SDS-PAGE separation of Human S100G protein (ab96001)
    Lane 1. Molecular weight marker: 14, 21, 31, 45, 66 and 97 kDa
    Lane 2. Reduced and heated sample, 5 µg per lane
    Lane 3. Non reduced and non heated sample, 5 µg per lane

References

ab96001 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab96001.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up