Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP29377
    • SpeciesHuman
    • SequenceMKHHHHHHASTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPS LLKGPNTLDDLFQELDKNGDGEVSFEEFQVLVKKISQ
    • Molecular weight10 kDa including tags
    • Amino acids2 to 79
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab96001 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 50mM Sodium chloride, 20mM Tris, pH 7.5

  • ReconstitutionAdd deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely.

General Info

  • Alternative names
    • CABP
    • CABP 1
    • CABP1
    • CABP9K
    • CALB3
    • Calbindin D9k
    • Calbindin-D9k
    • intestinal
    • Protein S100-G
    • S100 calcium binding protein G
    • S100 calcium-binding protein G
    • S100G
    • S100G_HUMAN
    • Vitamin D-dependent calcium-binding protein
    see all
  • Sequence similaritiesBelongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Information by UniProt

Recombinant Human S100G protein images

  • 14% SDS-PAGE separation of Human S100G protein (ab96001)
    Lane 1. Molecular weight marker: 14, 21, 31, 45, 66 and 97 kDa
    Lane 2. Reduced and heated sample, 5 µg per lane
    Lane 3. Non reduced and non heated sample, 5 µg per lane

References for Recombinant Human S100G protein (ab96001)

ab96001 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab96001.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"