Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GLGHGTFVAGVIASMRECQGFAPDAELHIFRVFTNNQVSYTSWFLDAFNY AILKKIDVLNLSIGGPDFMDHPFVDKVWELTANNVIMVSAIGNDGPLYGT LNNPADQMDV
    • Amino acids
      246 to 355
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160162 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • kexin isozyme 1
    • KIAA0091
    • MBTPS1
    • membrane bound transcription factor peptidase, site 1
    • MGC138711
    • MGC138712
    • PCSK8
    • S1P
    • S1P endopeptidase
    • Site 1 protease
    • SKI 1
    • SKI1
    • Subtilisin isozyme 1
    • Subtilisin/kexin isozyme 1
    see all
  • Relevance
    S1P (also known as MBTPS1,SKI1), was first discovered as one of two enzymes that cleave the sterol regulatory binding proteins (SREBPs), in the case of S1P at “site-1,” a hydrophillic loop extending into the lumen of the ER. The MBTPS1 domain structure contains a signal sequence followed by a propeptide domain, a catalytic domain, a transmembrane domain and a cytoplasmic domain.
  • Cellular localization
    Endoplasmic reticulum membrane; Single-pass type I membrane protein. Golgi apparatus membrane; Single-pass type I membrane protein.

Images

  • ab160162 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160162 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160162.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up