Overview

  • Product name
    Recombinant Human SA2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KRLRPEDSFMSVYPMQTEHHQTPLDYNRRGTSLMEDDEEPIVEDVMMSSE GRIEDLNEGMDFDTMDIDLPPSKNRRERTELKPDFFDPASIMDESVLGVS MF
    • Amino acids
      1130 to 1231
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161126 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bA517O1.1
    • Cohesin Subunit SA 2
    • Cohesin subunit SA-2
    • DKFZp686P168
    • DKFZp781H1753
    • FLJ25871
    • SA 2
    • SA-2
    • SA2
    • SCC3 homolog 2
    • SCC3B
    • STAG 2
    • stag2
    • STAG2_HUMAN
    • Stromal antigen 2
    see all
  • Function
    Component of cohesin complex, a complex required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The cohesin complex may also play a role in spindle pole assembly during mitosis.
  • Sequence similarities
    Belongs to the SCC3 family.
    Contains 1 SCD (stromalin conservative) domain.
  • Post-translational
    modifications
    Phosphorylated by PLK. The large dissociation of cohesin from chromosome arms during prophase is partly due to its phosphorylation.
  • Cellular localization
    Nucleus. Chromosome. Chromosome > centromere. Associates with chromatin. Before prophase it is scattered along chromosome arms. During prophase, most of cohesin complexes dissociate from chromatin probably because of phosphorylation by PLK, except at centromeres, where cohesin complexes remain. At anaphase, the RAD21 subunit of cohesin is cleaved, leading to the dissociation of the complex from chromosomes, allowing chromosome separation. In germ cells, cohesin complex dissociates from chromatin at prophase I, and may be replaced by a meiosis-specific cohesin complex.
  • Information by UniProt

Images

  • ab161126 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161126 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161126.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up