Recombinant Human SAC3D1 protein (ab162251)

Overview

  • Product name
    Recombinant Human SAC3D1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAGRRAQPGSAPPRPAAPHPRPASRAFPQHCRPRDAERPPSPRSPLMPGC ELPVGTCPDMCPAAERAQREREHRLHRLEVVPGCRQDPPRADPQRAVKEY SRPAAGKPRPPPSQLRPPSVLLATVRYLAGEVAESADIARAEVASFVADR LRAVRLDLALQGAGDAEAAVVLEAALATLLAVVARLGPDAARGPADPVLL QAQVQEGFGSLRRCYARGAGPHPRQPAFQGLFLLYNLGSVEALHEVLQLP AALRACPPLRKALAVDAAFREGNAARLFRLLQTLPYLPSCAVQCHVGHAR REALARFARAFSTPKGQTLPLGFMVNLLALDGLREARDLCQAHGLPLDGE ERVVFLRGRYVEEGLPPASTCKVLVESKLRGRTLEEVVMAEEEDEGTDRP GSPA
    • Amino acids
      1 to 404
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162251 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HSU79266
    • SAC3 domain-containing protein 1
    • SAC3 homology domain-containing protein 1
    • SHD1
  • Relevance
    Involved in centrosome duplication and mitotic progression.
  • Cellular localization
    Cytoplasm; cytoskeleton; centrosome By similarity. Cytoplasm; cytoskeleton; spindle By similarity. Note: Localizes on centrosomes in interphase cells and at spindles in mitosis

Images

  • ab162251 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162251 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162251.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up