Overview

  • Product name
    Recombinant Human SAFB protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DGQEDVETSLENLQDIDIMDISVLDEAEIDNGSVADCVEDDDADNLQESL SDSRELVEGEMKELPEQLQEHAIEDKETINNLDTSSSDFT
    • Molecular weight
      36 kDa including tags
    • Amino acids
      111 to 200

Specifications

Our Abpromise guarantee covers the use of ab116906 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp779C1727
    • glutathione S transferase fusion protein
    • HAP
    • HET
    • HSP27 ERE TATA binding protein
    • HSP27 ERE-TATA-binding protein
    • HSP27 estrogen response element-TATA box-binding protein
    • SAF B
    • SAF-B
    • SAF-B1
    • SAFB
    • SAFB 1
    • SAFB1
    • SAFB1_HUMAN
    • Scaffold attachment factor B1
    see all
  • Function
    Binds to scaffold/matrix attachment region (S/MAR) DNA and forms a molecular assembly point to allow the formation of a 'transcriptosomal' complex (consisting of SR proteins and RNA polymerase II) coupling transcription and RNA processing (By similarity). Can function as an estrogen receptor corepressor and can also bind to the HSP27 promoter and decrease its transcription. Can inhibit cell proliferation.
  • Tissue specificity
    Ubiquitous. Expressed at high levels in the CNS and at low levels in the liver. Expressed in a wide number of breast cancer cell lines.
  • Sequence similarities
    Contains 1 RRM (RNA recognition motif) domain.
    Contains 1 SAP domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116906 at approximately 35.53 kDa.

References

ab116906 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116906.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up