Overview

  • Product name
    Recombinant Human SALL2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAHESERSSRLGVPCGEPAELGGDASEEDHPQVCAKCCAQFTDPTEFLAH QNACSTDPPVMVIIGGQENPNNSSASSEPRPEGHNNPQVMDTEHSNPPDS GSSVPTDPTWGPERRGEESPGHFLVAATEPVCGIPVKWPAHEALEFQLHL HYHSKPGPTSAVWPRNCGWEGASNNGIQGSQGEDSPPPISASCTQGSA
    • Amino acids
      1 to 198
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159471 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI225809
    • AW559097
    • FLJ10414
    • FLJ55746
    • HSAL2
    • KIAA0360
    • mKIAA0360
    • Msal-2
    • p150 Sal2
    • p150(Sal2)
    • Sal like protein 2
    • Sal-2
    • Sal-like 2
    • Sal-like 2 (Drosophila)
    • Spalt-like protein 2
    • Zinc finger protein SALL2
    • Zinc finger protein Spalt-2
    • ZNF795
    see all
  • Relevance
    The region-specific homeotic gene sal (spalt) of Drosophila encodes a zinc finger protein of unusual but characteristic structure. These unique features were used to isolate sal-like genes from humans. Two sal-like transcription units SALL1 and SALL2, located on chromosomes 16q12.1 and 14q11.1-q12.1 respectively, have been isolated and characterized. SALL1 and SALL2 transcripts are expressed in a limited number of adult organs, including the brain. SALL2 is evenly expressed in different brain areas. Transcripts of both genes can be detected in fetal brain neurons. The arrangement of sal-like zinc finger domains and their high degree of sequence similarity suggest a novel and conserved subfamily of human zinc finger transcription factors that is closely related to the Drosophila gene product encoded by the gene sal.
  • Cellular localization
    Nuclear

Images

  • ab159471 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159471 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159471.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up