Overview

  • Product name
    Recombinant Human Sall4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLG ATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKIAVS
    • Amino acids
      954 to 1053
    • Tags
      proprietary tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab153444 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AA407717
    • AL022809
    • AW536104
    • C330011P20Rik
    • C78083
    • C78563
    • dJ1112F19.1
    • DRRS
    • HSAL4
    • Sal like 4
    • Sal like 4 (Drosophila)
    • Sal like Protein 4
    • Sal-like protein 4
    • Sall4
    • SALL4_HUMAN
    • Spalt like transcription factor 4
    • Tex20
    • Zinc finger protein 797
    • Zinc finger protein SALL4
    • ZNF797
    see all
  • Function
    Probable transcription factor.
  • Tissue specificity
    Expressed in testis.
  • Involvement in disease
    Defects in SALL4 are the cause of Duane-radial ray syndrome (DRRS) [MIM:607323]; also known as Okihiro syndrome. DRRS is a disorder characterized by the association of forearm malformations with Duane retraction syndrome.
    Defects in SALL4 are the cause of oculootoradial syndrome (OORS) [MIM:147750]. Oculootoradial syndrome is an autosomal dominant condition characterized by upper limbs anomalies (radial ray defects, carpal bones fusion), extraocular motor disturbances, congenital bilateral non-progressive mixed hearing loss. Other less consistent malformations include heart involvement, mild thrombocytopenia and leukocytosis (before age 50), shoulder girdle hypoplasia, imperforate anus, kidney malrotation or rectovaginal fistula. The IVIC syndrome is an allelic disorder of Duane-radial ray syndrome (DRRS) with a similar phenotype.
  • Sequence similarities
    Belongs to the sal C2H2-type zinc-finger protein family.
    Contains 7 C2H2-type zinc fingers.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab153444 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153444 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153444.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up