Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNM DLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLN
    • Amino acids
      176 to 275
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153110 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ34027
    • GAP associated tyrosine phosphoprotein p62
    • GAP-associated tyrosine phosphoprotein p62
    • KH domain containing RNA binding signal transduction associated 1
    • KH domain-containing
    • KHDR1_HUMAN
    • Khdrbs1
    • p21 Ras GTPase activating protein associated p62
    • p21 Ras GTPase-activating protein-associated p62
    • p62
    • p68
    • RNA-binding
    • Sam68
    • signal transduction-associated protein 1
    • Src associated in mitosis 68 kDa protein
    • Src-associated in mitosis 68 kDa protein
    see all
  • Function
    Recruited and tyrosine phosphorylated by several receptor systems, for example the T-cell, leptin and insulin receptors. Once phosphorylated, functions as an adapter protein in signal transduction cascades by binding to SH2 and SH3 domain-containing proteins. Role in G2-M progression in the cell cycle. Represses CBP-dependent transcriptional activation apparently by competing with other nuclear factors for binding to CBP. Also acts as a putative regulator of mRNA stability and/or translation rates and mediates mRNA nuclear export.
    Isoform 3, which is expressed in growth-arrested cells only, inhibits S phase.
  • Tissue specificity
    Ubiquitously expressed in all tissue examined. Isoform 1 is expressed at lower levels in brain, skeletal muscle, and liver whereas isoform 3 is intensified in skeletal muscle and in liver.
  • Sequence similarities
    Belongs to the KHDRBS family.
    Contains 1 KH domain.
  • Developmental stage
    Isoform 3 is only expressed in growth-arrested cells.
  • Domain
    The KH domain is required for binding to RNA.
    The Pro-rich domains are flanked by Arg/Gly-rich motifs which can be asymmetric dimethylated on arginine residues to give the DMA/Gly-rich regions. Selective methylation on these motifs can modulate protein-protein interactions.
  • Post-translational
    modifications
    Tyrosine phosphorylated by several non-receptor tyrosine kinases, for example LCK, FYN and JAK3. Negatively correlates with ability to bind RNA but required for many interactions with proteins.
    Acetylated. Positively correlates with ability to bind RNA.
    Arginine methylation is required for nuclear localization. Also can affect interaction with other proteins. Inhibits interaction with Src-like SH3 domains, but not interaction with WW domains of WBP4/FBP21 AND FNBP4/FBP30.
    Arg-291, Arg-331 and Arg-346 are found to be also dimethylated, probably to asymmetric dimethylarginine.
  • Cellular localization
    Nucleus. Membrane.
  • Information by UniProt

Images

  • ab153110 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153110 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153110.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up