Recombinant Human SAMHD1 protein (ab153254)

Overview

  • Product name
    Recombinant Human SAMHD1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQRADSEQPSKRPRCDDSPRTPSNTPSAEADWSPGLELHPDYKTWGPEQV CSFLRRGGFEEPVLLKNIRENEITGALLPCLDESRFENLGVSSLGERKKL LSYIQRLVQIHVDTMKVINDPIHGHIELHPLLVRIIDTPQFQRLRYIKQL GGGYYVFPGASHNRFEHSLGVGYLAGCLVHALGEKQPELQISERDVLCVQ IAGLCHDLGHGPFSHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINSNGI KPVMEQYGLIPEEDICFIKEQIVGPLESPVEDSLWPYKGRPENKSFLYEI VSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKFARVCEVDNELRIC ARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEIT GAGGKKYRISTAIDDMEAYTKLTDNIFLEILYSTDPKLKDAREILKQIEY RNLFKYVGETQPTGQIKIKREDYESLPKEVASAKPKVLLDVKLKAEDFIV DVINMDYGMQEKNPIDHVSFYCKTAPNRAIRITKNQVSQLLPEKFAEQLI RVYCKKVDRKSLYAARQYFVQWCADRNFTKPQDGDVIAPLITPQKKEWND STSVQNPTRLREASKSRVQLFKDDPM
    • Amino acids
      1 to 626
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153254 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CHBL2
    • DCIP
    • Dendritic cell derived IFNG induced protein
    • Dendritic cell-derived IFNG-induced protein
    • Deoxynucleoside triphosphate triphosphohydrolase SAMHD1
    • dNTPase
    • HD domain containing 1
    • HDDC1
    • Mg11
    • Monocyte protein 5
    • MOP 5
    • MOP-5
    • MOP5
    • OTTHUMP00000030889
    • SAM domain and HD domain 1
    • SAM domain and HD domain containing protein 1
    • SAM domain and HD domain-containing protein 1
    • SAMH1_HUMAN
    • Samhd1
    • SBBI88
    see all
  • Function
    Putative nuclease involved in innate immune response by acting as a negative regulator of the cell-intrinsic antiviral response. May play a role in mediating proinflammatory responses to TNF-alpha signaling.
  • Tissue specificity
    Expressed in heart, skeletal muscle, spleen, liver, small intestine, placenta, lung and peripheral blood leukocytes. No expression is seen in brain and thymus.
  • Involvement in disease
    Defects in SAMHD1 are the cause of Aicardi-Goutieres syndrome type 5 (AGS5) [MIM:612952]. A form of Aicardi-Goutieres syndrome, a genetically heterogeneous disease characterized by cerebral atrophy, leukoencephalopathy, intracranial calcifications, chronic cerebrospinal fluid (CSF) lymphocytosis, increased CSF alpha-interferon, and negative serologic investigations for common prenatal infection. Clinical features as thrombocytopenia, hepatosplenomegaly and elevated hepatic transaminases along with intermittent fever may erroneously suggest an infective process. Severe neurological dysfunctions manifest in infancy as progressive microcephaly, spasticity, dystonic posturing and profound psychomotor retardation. Death often occurs in early childhood.
  • Sequence similarities
    Belongs to the SAMHD1 family.
    Contains 1 HD domain.
    Contains 1 SAM (sterile alpha motif) domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab153254 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153254 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153254.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up