Recombinant Human SAMM50 protein (ab161796)

Overview

  • Product name
    Recombinant Human SAMM50 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGTVHARSLEPLPSSGPDFGGLGEEAEFVEVEPEAKQEILENKDVVVQHV HFDGLGRTKDDIIICEIGDVFKAKNLIEVMRKSHEAREKLLRLGIFRQVD VLIDTCQGDDALPNGLDVTFEVTELRRLTGSYNTMVGNNEGSMVLGLKLP NLLGRAEKVTFQFSYGTKETSYGLSFFKPRPGNFERNFSVNLYKVTGQFP WSSLRETDRGMSAEYSFPIWKTSHTVKWEGVWRELGCLSRTASFAVRKES GHSLKSSLSHAMVIDSRNSSILPRRGALLKVNQELAGYTGGDVSFIKEDF ELQLNKQLIFDSVFSASFWGGMLVPIGDKPSSIADRFYLGGPTSVRGFSM HSIGPQSEGDYLGGEAYWAGLHLYTPLPFRPGQGGFGELFRTHFFLNAGN LCNLNYGEGPKAHIRKLAECIRWSYGAGIVLRLGNIARLELNYCVPMGVQ TGDRICDGVQFGAGIRFL
    • Amino acids
      1 to 468
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161796 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CGI 51
    • CGI-51
    • FLJ35825
    • FLJ42905
    • FLJ99036
    • OMP85
    • SAM50
    • SAM50_HUMAN
    • Samm50
    • sorting and assembly machinery 50kDa
    • Sorting and assembly machinery component 50 homolog
    • sorting and assembly machinery component 50 homolog (S. cerevisiae)
    • sorting and assembly machinery component 50, S. cerevisiae, homolog of
    • TOB55
    • Transformation-related gene 3 protein
    • TRG-3
    • YNL026W
    see all
  • Function
    May be required for the assembly pathway of mitochondrial outer membrane proteins.
  • Sequence similarities
    Belongs to the SAM50/omp85 family.
  • Domain
    Its C-terminal part seems to contain many membrane-spanning sided beta-sheets, that have the potential to adopt a transmembrane beta-barrel type structure.
  • Cellular localization
    Mitochondrion outer membrane. Cytoplasm.
  • Information by UniProt

Images

  • ab161796 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161796 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161796.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up