Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNGFTPDEMSRGGDAAAAVAAVVAAAAAAASAGNGTGAGTGAEVPGAGAV SAAGPPGAAGPGPGQLCCLREDGERCGRAAGNASFSKRIQKSISQKKVKI ELDKSARHLYICDYHKNLIQSVRNRRKRKGSDDDGGDSPVQDIDTPEVDL YQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTLTYF IYSVKNDKNKSDLKVDSGVH
    • Amino acids
      1 to 220
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160208 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 30 kDa Sin3-associated polypeptide
    • Histone deacetylase complex subunit SAP 30
    • Histone deacetylase complex subunit SAP30
    • MSin3A associated polypeptide p30
    • SAP 30
    • Sap30
    • SAP30_HUMAN
    • Sin3 associated polypeptide
    • Sin3 associated polypeptide 30 kDa
    • Sin3 associated polypeptide 30kD
    • Sin3 corepressor complex subunit SAP 30
    • Sin3 corepressor complex subunit SAP30
    • Sin3-associated polypeptide p30
    • Sin3A associated protein
    • Sin3A associated protein 30kDa
    see all
  • Function
    Involved in the functional recruitment of the Sin3-histone deacetylase complex (HDAC) to a specific subset of N-CoR corepressor complexes. Capable of transcription repression by N-CoR. Active in deacetylating core histone octamers (when in a complex) but inactive in deacetylating nucleosomal histones.
  • Tissue specificity
    Expressed in all tissues tested with highest levels in pancreas, ovary, PBL, spleen and thymus; lowest levels in brain, placenta, lung and kidney.
  • Sequence similarities
    Belongs to the SAP30 family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab160208 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160208 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160208.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up