Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSSPPPARSGFYRQEVTKTAWEVRAVYRDL QPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKH MRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRI QFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADS EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSD HLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNA SPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSF DDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL
    • Molecular weight
      44 kDa including tags
    • Amino acids
      1 to 367
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab117221 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab117221 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • ERK 6
    • ERK-6
    • ERK6
    • Extracellular signal-regulated kinase 6
    • MAP kinase 12
    • MAP kinase p38 gamma
    • MAPK 12
    • Mapk12
    • Mitogen Activated Protein Kinase 12
    • Mitogen activated protein kinase p38 gamma
    • Mitogen-activated protein kinase 12
    • Mitogen-activated protein kinase p38 gamma
    • MK12_HUMAN
    • P38 GAMMA
    • P38GAMMA
    • PRKM12
    • SAPK 3
    • SAPK-3
    • SAPK3
    • Stress Activated Protein Kinase 3
    • Stress-activated protein kinase 3
    see all
  • Function
    Responds to activation by environmental stress and pro-inflammatory cytokines by phosphorylating downstream targets. Plays a role in myoblast differentiation and also in the down-regulation of cyclin D1 in response to hypoxia in adrenal cells suggesting MAPK12 may inhibit cell proliferation while promoting differentiation.
  • Tissue specificity
    Highly expressed in skeletal muscle and heart.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
    Contains 1 protein kinase domain.
  • Domain
    The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases.
  • Post-translational
    modifications
    Dually phosphorylated on Thr-183 and Tyr-185, which activates the enzyme.
  • Cellular localization
    Cytoplasm. Mitochondrion. Mitochondrial when associated with SH3BP5.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab117221 at approximately 44.1kDa (3µg).

References

ab117221 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117221.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up