Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO15264
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSLIRKKGFYKQDVNKTAWELPKTYVSPTH VGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQ HENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYL VYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMT GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLD QLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQ AADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEH EKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL
    • Molecular weight44 kDa including tags
    • Amino acids1 to 365
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113869 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab113869 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT

General Info

  • Alternative names
    • MAP kinase 13
    • MAP kinase p38 delta
    • MAPK 13
    • MAPK-13
    • Mapk13
    • MGC99536
    • Mitogen activated protein kinase 13
    • Mitogen-activated protein kinase 13
    • Mitogen-activated protein kinase p38 delta
    • MK13_HUMAN
    • OTTHUMP00000016282
    • OTTHUMP00000016283
    • p38 delta
    • P38delta
    • PRKM13
    • SAPK 4
    • SAPK4
    • Stress activated protein kinase 4
    • Stress-activated protein kinase 4
    see all
  • FunctionResponds to activation by environmental stress and pro-inflammatory cytokines by phosphorylating downstream targets. Plays a role in the regulation of protein translation by phosphorylating and inactivating EEF2K.
  • Tissue specificityExpressed in testes, pancreas, small intestine, lung and kidney. Abundant in macrophages, also present in neutrophils, CD4+ T-cells, and endothelial cells.
  • Sequence similaritiesBelongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
    Contains 1 protein kinase domain.
  • DomainThe TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases.
  • Post-translational
    modifications
    Dually phosphorylated on Thr-180 and Tyr-182, which activates the enzyme.
  • Information by UniProt

Recombinant Human SAPK4 protein images

  • 15% SDS-PAGE analysis of 3 µg ab113869.

References for Recombinant Human SAPK4 protein (ab113869)

ab113869 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113869.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"