Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGEFMSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDN AGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMTFTTFDLGGHEQARRV WKNYLPAINGIVFLVDCADHSRLVESKVELNALMTDETISNVPILILGNK IDRTDAISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMCSVLKRQG YGEGFRWLSQYID
    • Molecular weight
      24 kDa including tags
    • Amino acids
      1 to 198
    • Tags
      T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab169876 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab169876 was expressed in E.coli as inclusion bodies, refolded and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituent: 0.32% Tris-HCl buffer
    Note: Contains NaCl, KCl, EDTA, arginine, DTT and glycerol.

General Info

  • Alternative names
    • COPII associated small GTPase
    • COPII-associated small GTPase
    • GTP binding protein SAR1a
    • GTP-binding protein SAR1a
    • Masra 2
    • Masra2
    • SAR 1
    • SAR1 gene homolog A
    • SAR1 homolog A (S. cerevisiae)
    • SAR1A
    • SAR1a gene homolog (S cerevisiae) 1
    • SAR1a gene homolog 1
    • SAR1a gene homolog 1 (S cerevisiae)
    • SAR1A_HUMAN
    • Sara
    • SARA 1
    • SARA1
    see all
  • Function
    Involved in transport from the endoplasmic reticulum to the Golgi apparatus (By similarity). Required to maintain SEC16A localization at discrete locations on the ER membrane perhaps by preventing its dissociation. SAR1A-GTP-dependent assembly of SEC16A on the ER membrane forms an organized scaffold defining endoplasmic reticulum exit sites (ERES).
  • Sequence similarities
    Belongs to the small GTPase superfamily. SAR1 family.
  • Cellular localization
    Endoplasmic reticulum. Golgi apparatus.
  • Information by UniProt

References

ab169876 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169876.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up