Recombinant Human Sarcomeric Alpha Actinin protein (ab92234)

Overview

  • Product nameRecombinant Human Sarcomeric Alpha Actinin protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRTIPWLENRTPE KTM QAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQTKLRISNRP AFMPSEGK MVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERLEHLAEKF RQKASTHETWAYG KEQILLQKDYESASLTEVRALLRKHEAFESDLAAH QDRVEQIAAIAQELNELD YHDAVNVNDRCQKICDQWDRLGTLTQKRRE ALERMEKLLETIDQLHLEFAKRA APFNNWMEGAMEDLQDMFIVHSIEE IQSLITAHEQFKATLPEADGERQSIMAI QNEVEKVIQSYNIRISSSNP YSTVTMDELRTKWDKVKQLVPIRDQSLQEELAR QHANERLRRQFAAQA NAIGPWIQNKMEEIARSSIQITGALEDQMNQLKQYEHN IINYKNNIDK LEGDHQLIQEALVFDNKHTNYTMEHIRVGWELLLTTIARTINE VETQI LTRDAKGITQEQMNEFRASFNHFDRRKNGLMDHEDFRACLISMGYDLG EAEFARIMTLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILAS DKP YILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALDYAAFSS
    • Amino acids261 to 886

Specifications

Our Abpromise guarantee covers the use of ab92234 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • ReconstitutionReconstitution with 136 µl aqua dest.

General Info

  • Alternative names
    • Actin binding protein
    • Actinin alpha 2
    • ACTN 2
    • ACTN2
    • ACTN2_HUMAN
    • Alpha actinin 2
    • Alpha actinin skeletal muscle
    • Alpha actinin skeletal muscle isoform 2
    • Alpha-actinin skeletal muscle isoform 2
    • Alpha-actinin-2
    • CMD1AA
    • F actin cross linking protein
    • F-actin cross-linking protein
    see all
  • FunctionF-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein.
  • Tissue specificityExpressed in both skeletal and cardiac muscle.
  • Involvement in diseaseDefects in ACTN2 are the cause of cardiomyopathy dilated type 1AA (CMD1AA) [MIM:612158]. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.
  • Sequence similaritiesBelongs to the alpha-actinin family.
    Contains 1 actin-binding domain.
    Contains 2 CH (calponin-homology) domains.
    Contains 2 EF-hand domains.
    Contains 4 spectrin repeats.
  • Cellular localizationCytoplasm > myofibril > sarcomere > Z line. Colocalizes with MYOZ1 and FLNC at the Z-lines of skeletal muscle.
  • Information by UniProt

Recombinant Human Sarcomeric Alpha Actinin protein images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References for Recombinant Human Sarcomeric Alpha Actinin protein (ab92234)

ab92234 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab92234.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"