Overview

  • Product name
    Recombinant Human SASH1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ENTSLQEHGVKLGPALTRKVSCARGVDLETLTENKLHAEGIDLTEEPYSD KHGRCGIPEALVQRYAEDLDQPERDVAANMDQIRVKQLRKQHRMAIPSGG LTEICRKPVS
    • Amino acids
      1066 to 1175
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161604 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2500002E12Rik
    • dJ323M4
    • dJ323M4.1
    • KIAA0790
    • PEPE 1
    • PEPE1
    • Proline glutamate repeat containing protein
    • Proline-glutamate repeat-containing protein
    • RP3 323M4.1
    • SAM and SH3 domain containing 1
    • SAM and SH3 domain containing protein 1
    • SAM and SH3 domain-containing protein 1
    • SASH 1
    • Sash1
    • SASH1_HUMAN
    see all
  • Function
    May have a role in a signaling pathway. Could act as a tumor suppressor.
  • Tissue specificity
    Expressed ubiquitously, with highest levels in lung, placenta, spleen and thymus. Down-regulated in the majority (74%) of breast tumors in comparison with corresponding normal breast epithelial tissues.
  • Sequence similarities
    Contains 2 SAM (sterile alpha motif) domains.
    Contains 1 SH3 domain.
  • Information by UniProt

Images

  • ab161604 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161604 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161604.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up