Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAKFVIRPATAADCSDILRLIKELAKYEYM EEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFT YDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVA EWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
    • Molecular weight
      22 kDa including tags
    • Amino acids
      1 to 171
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab117173 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    ab117173 is purified by proprietary chromatographic techniques.
  • Form
    Liquid
  • Additional notes
    Although stable 4°C for 4 weeks, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • DC21
    • Diamine acetyltransferase 1
    • Diamine N acetyltransferase 1
    • EC 2.3.1.57
    • KFSD
    • KFSDX
    • Polyamine N acetyltransferase 1
    • Polyamine N-acetyltransferase 1
    • Putrescine acetyltransferase
    • SAT
    • SAT1
    • SAT1_HUMAN
    • Spermidine/spermine N(1) acetyltransferase 1
    • Spermidine/spermine N(1)-acetyltransferase 1
    • Spermidine/spermine N1 acetyltransferase 1
    • Spermidine/spermine N1 acetyltransferase alpha
    • SSAT
    • SSAT 1
    • SSAT-1
    see all
  • Function
    Enzyme which catalyzes the acetylation of polyamines. Substrate specificity: norspermidine = spermidine >> spermine > N(1)-acetylspermine > putrescine. This highly regulated enzyme allows a fine attenuation of the intracellular concentration of polyamines. Also involved in the regulation of polyamine transport out of cells. Acts on 1,3-diaminopropane, 1,5-diaminopentane, putrescine, spermidine (forming N(1)- and N(8)-acetylspermidine), spermine, N(1)-acetylspermidine and N(8)-acetylspermidine.
  • Pathway
    Amine and polyamine degradation; putrescine degradation; N-acetylputrescine from putrescine: step 1/1.
  • Involvement in disease
    Keratosis follicularis spinulosa decalvans X-linked
  • Sequence similarities
    Belongs to the acetyltransferase family.
    Contains 1 N-acetyltransferase domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References for Recombinant Human SAT1 protein (ab117173)

ab117173 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117173.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up