Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAKFVIRPATAADCSDILRLIKELAKYEYM EEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFT YDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVA EWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE
    • Molecular weight
      22 kDa including tags
    • Amino acids
      1 to 171
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab117173 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    ab117173 is purified by proprietary chromatographic techniques.
  • Form
    Liquid
  • Additional notes
    Although stable 4°C for 4 weeks, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • DC21
    • Diamine acetyltransferase 1
    • Diamine N acetyltransferase 1
    • EC 2.3.1.57
    • KFSD
    • KFSDX
    • Polyamine N acetyltransferase 1
    • Polyamine N-acetyltransferase 1
    • Putrescine acetyltransferase
    • SAT
    • SAT1
    • SAT1_HUMAN
    • Spermidine/spermine N(1) acetyltransferase 1
    • Spermidine/spermine N(1)-acetyltransferase 1
    • Spermidine/spermine N1 acetyltransferase 1
    • Spermidine/spermine N1 acetyltransferase alpha
    • SSAT
    • SSAT 1
    • SSAT-1
    see all
  • Function
    Enzyme which catalyzes the acetylation of polyamines. Substrate specificity: norspermidine = spermidine >> spermine > N(1)-acetylspermine > putrescine. This highly regulated enzyme allows a fine attenuation of the intracellular concentration of polyamines. Also involved in the regulation of polyamine transport out of cells. Acts on 1,3-diaminopropane, 1,5-diaminopentane, putrescine, spermidine (forming N(1)- and N(8)-acetylspermidine), spermine, N(1)-acetylspermidine and N(8)-acetylspermidine.
  • Pathway
    Amine and polyamine degradation; putrescine degradation; N-acetylputrescine from putrescine: step 1/1.
  • Involvement in disease
    Keratosis follicularis spinulosa decalvans X-linked
  • Sequence similarities
    Belongs to the acetyltransferase family.
    Contains 1 N-acetyltransferase domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab117173 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117173.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up