Overview

  • Product name
    Recombinant Human SC11A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIV VVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLK IHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGFVPYIG IVTILMNDYPKFKYAVLFLLGLFVLVHRE
    • Amino acids
      1 to 179
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161662 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1810012E07Rik
    • Endopeptidase SP18
    • Microsomal signal peptidase 18 kDa subunit
    • SC11A_HUMAN
    • SEC11 homolog A
    • SEC11 homolog A (S. cerevisiae)
    • SEC11-like protein 1
    • SEC11A
    • SEC11L1
    • sid2895
    • Signal peptidase complex (18kD)
    • Signal peptidase complex catalytic subunit SEC11A
    • SPase 18 kDa subunit
    • SPC18
    • SPCS4A
    see all
  • Function
    Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.
  • Sequence similarities
    Belongs to the peptidase S26B family.
  • Cellular localization
    Microsome membrane. Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab161662 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161662 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161662.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up