Recombinant Human Scaffold attachment factor B2 protein (ab160602)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAETLPGSGDSGPGTASLGPGVAETGTRRLSELRVIDLRAELKKRNLDTG GNKSVLMERLKKAVKEEGQDPDEIGIELEATSKKSAKRCVKGLKMEEEGT EDNGLEDDSRDGQEDMEASLENLQNMGMMDMSVLDETEVANSSAPDFGED GTDGLLDSFCDSKEYVAAQLRQLPAQPPEHAVDGEGFKNTLETSSLNFKV TPDIEESLLEPENEKILDILGETCKSEPVKEESSELEQPFAQDTSSVGPD RKLAEEEDLFDSAHPEEGDLDLASESTAHAQSSKADSLLAVVKREPAEQP GDGERTDCEPVGLEPAVEQSSAASELAEASSEELAEAPTEAPSPEARDSK EDGRKFDFDACNEVPPAPKESSTSEGADQKMSSFKEEKDIKPIIKDEKGR VGSGSGRNLWVSGLSSTTRATDLKNLFSKYGKVVGAKVVTNARSPGARCY GFVTMSTSDEATKCISHLHRTELHGRMISVEKAKNEPAGKKLSDRKECEV KKEKLSSVDRHHSVEIKIEKTVIKKEEM
    • Amino acids
      1 to 528
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160602 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZP779C1727
    • HAP
    • HET
    • hsp27 ere tata binding
    • KIAA0138
    • SAF B
    • SAF B2
    • SAF-B2
    • SAFB
    • SAFB1
    • SAFB2
    • SAFB2_HUMAN
    • Scaffold attachment factor B2
    see all
  • Function
    Binds to scaffold/matrix attachment region (S/MAR) DNA. Can function as an estrogen receptor corepressor and can also inhibit cell proliferation.
  • Tissue specificity
    Expressed at high levels in the CNS and at low levels in the liver. Expressed in a wide number of breast cancer cell lines.
  • Sequence similarities
    Contains 1 RRM (RNA recognition motif) domain.
    Contains 1 SAP domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab160602 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160602 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160602.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up