Recombinant Human SCAPER protein (ab162333)

Overview

  • Product name
    Recombinant Human SCAPER protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGLIDKLCACFLSVQGPVDENPKMAIFLQHAAGLLHAMCTLCFAVTGRSY SIFDNNRQDPTGLTAALQATDLAGVLHMLYCVLFHGTILDPSTASPKENY TQNTIQVAIQSLRFFNSFAALHLPAFQSIVGAEGLSLAFRHMASSLLGHC SQVSCESLLHEVIVCVGYFTVNHPDNQVIVQSGRHPTVLQKLCQLPFQYF SDPRLIKVLFPSLIAACYNNHQNKIILEQEMSCVLLATFIQDLAQTPGQA ENQPYQPKGKCLGSQDYLELANRFPQQAWEEARQFFLKKEKK
    • Amino acids
      1 to 292
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162333 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ31533
    • FLJ31953
    • FLJ46212
    • KIAA1454
    • MSTP063
    • S phase cyclin A-associated protein in the endoplasmic reticulum
    • S phase cyclin A-associated protein in the ER
    • SCAPE_HUMAN
    • SCAPER
    • Zfp291
    • Zinc finger protein 291
    • ZNF291
    see all
  • Function
    CCNA2/CDK2 regulatory protein that transiently maintains CCNA2 in the cytoplasm.
  • Tissue specificity
    Widely expressed with highest expression in testis.
  • Sequence similarities
    Contains 1 C2H2-type zinc finger.
  • Developmental stage
    Expressed at each stage of the cell cycle, including G0, although the expression is somewhat higher in late G1 and S phases.
  • Post-translational
    modifications
    Phosphorylated in vitro by the CCNA2/CDK2 complex.
  • Cellular localization
    Endoplasmic reticulum. Nucleus. Predominantly located in the endoplasmic reticulum, only a small portion is detected in the nucleus.
  • Information by UniProt

Images

  • ab162333 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162333 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162333.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up