Recombinant Human Scavenging Receptor SR-BI protein (ab158057)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSS LSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHK SNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILVLGAAVMMEN KPMTLKLIMTLAFTTLGERAFMNRTVGEIMWGYKDPLVNLINKYFPGMFP FKDKFGLFAELNNSDSGLFTVFTGVQNISRIHLVDKWNGLSKVDFWHSDQ CNMINGTSGQMWPPFMTPESSLEFYSPEACRSMKLMYKESGVFEGIPTYR FVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNA DPVLAEAVTGLHPNQEAHSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGI GQTGKIEPVVLPLLWFAESGAMEGETLHTFYTQLVLMPKVMHYAQYVLLA LGCVLLLVPVICQIRSQVGAGQRAARADSHSLACWGKGASDRTLWPTAAW SPPPAAVLRLCRSGSGHCWGLRSTLASFACRVATTLPVLEGLGPSLGGGT GS
    • Amino acids
      1 to 552
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158057 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD36
    • CD36 and LIMPII analogous 1
    • CD36 Antigen like 1
    • CD36 antigen-like 1
    • CD36L1
    • CLA 1
    • CLA-1
    • CLA1
    • Collagen type I receptor
    • HDLQTL6
    • MGC138242
    • SCARB1
    • Scavebger Receptor Class B Member 1
    • Scavenger receptor class B member 1
    • Scavenger Receptor Class B Type 1
    • SCRB1_HUMAN
    • SR BI
    • SR-BI
    • SRB1
    • SRBI
    • Thrombospondin receptor like 1
    • thrombospondin receptor-like 1
    see all
  • Function
    Receptor for different ligands such as phospholipids, cholesterol ester, lipoproteins, phosphatidylserine and apoptotic cells. Probable receptor for HDL, located in particular region of the plasma membrane, called caveolae. Facilitates the flux of free and esterified cholesterol between the cell surface and extracellular donors and acceptors, such as HDL and to a lesser extent, apoB-containing lipoproteins and modified lipoproteins. Probably involved in the phagocytosis of apoptotic cells, via its phosphatidylserine binding activity. Receptor for hepatitis C virus glycoprotein E2. Binding between SCARB1 and E2 was found to be independent of the genotype of the viral isolate. Plays an important role in the uptake of HDL cholesteryl ester.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the CD36 family.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Cell membrane. Membrane > caveola. Predominantly localized to cholesterol and sphingomyelin-enriched domains within the plasma membrane, called caveolae.
  • Information by UniProt

Images

  • ab158057 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158057 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158057.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up