Recombinant human Scavenging Receptor SR-BI protein (Fc Chimera) (ab182680)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant human Scavenging Receptor SR-BI protein (Fc Chimera)
See all Scavenging Receptor SR-BI proteins and peptides -
Biological activity
Measured by its ability to bind recombinant Human ApoAI in a functional ELISA.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
PSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGE KPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESD YIVMPNILVLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIMWG YKDPLVNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGVQNISRIH LVDKWNGLSKVDFWHSDQCNMINGTSGQMWPPFMTPESSLEFYSPEACRS MKLMYKESGVFEGIPTYRFVAPKTLFANGSIYPPNEGFCPCLESGIQNVS TCRFSAPLFLSHPHFLNADPVLAEAVTGLHPNQEAHSLFLDIHPVTGIPM NCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESGAMEGETLHTFYT QLVLMPKVMHY -
Predicted molecular weight
73 kDa including tags -
Amino acids
33 to 443 -
Additional sequence information
Fused with Fc fragment of Human IgG1 at the C-terminus. NP_005496.4. Extracellular domain.
-
Specifications
Our Abpromise guarantee covers the use of ab182680 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Additional notes
As a result of glycosylation, DTT-reduced Scavenging Receptor SR-BI protein migrates as 110-115 kDa and non-reduced protein migrates as 220-230 kDa.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle.
pH: 7.4
Constituents: 0.6% Tris, 0.75% Glycine, 5% Trehalose
Lyophilized from 0.22 µm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionIt is recommended to reconstitute the lyophilized product in 250 µl sterile deionized water to a final concentration of 200 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.
General Info
-
Alternative names
- CD36
- CD36 and LIMPII analogous 1
- CD36 Antigen like 1
see all -
Function
Receptor for different ligands such as phospholipids, cholesterol ester, lipoproteins, phosphatidylserine and apoptotic cells. Probable receptor for HDL, located in particular region of the plasma membrane, called caveolae. Facilitates the flux of free and esterified cholesterol between the cell surface and extracellular donors and acceptors, such as HDL and to a lesser extent, apoB-containing lipoproteins and modified lipoproteins. Probably involved in the phagocytosis of apoptotic cells, via its phosphatidylserine binding activity. Receptor for hepatitis C virus glycoprotein E2. Binding between SCARB1 and E2 was found to be independent of the genotype of the viral isolate. Plays an important role in the uptake of HDL cholesteryl ester. -
Tissue specificity
Widely expressed. -
Sequence similarities
Belongs to the CD36 family. -
Post-translational
modificationsN-glycosylated. -
Cellular localization
Cell membrane. Membrane > caveola. Predominantly localized to cholesterol and sphingomyelin-enriched domains within the plasma membrane, called caveolae. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab182680 has not yet been referenced specifically in any publications.