Recombinant Human SCC112 protein (ab161580)

Overview

  • Product name
    Recombinant Human SCC112 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MIHLLAHDPDFTRSQDVDQLRDIKECLWFMLEVLMTKNENNSHAFMKKMA ENIKLTRDAQSPDESKTNEKLYTVCDVALCVINSKSALCNADSPKDPVLP MKFFTQPEKDFCNDKSYISEETRVLLLTGKPKPAGVLGAVNKPLSATGRK PYVRSTGTETGSNINVNSELNPSTGNRSREQSSEAAETGVSENEENPVRI ISVTPVKNIDPVKNKEINSDQATQGNISSDRGKKRTVTAAGAENIQQKTD EKVDESGPPAPSKPRRGRRPKSESQGNATKNDDLNKPINKGRKRAAVGQE SPGGLEAGNAKAPKLQDLAKKAAPAERQIDLQR
    • Amino acids
      1 to 333
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161580 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cell proliferation inducing protein 54
    • Cell proliferation-inducing gene 54 protein
    • KIAA0648
    • PDS5, regulator of cohesion maintenance, homolog A (S. cerevisiae)
    • PDS5A
    • PDS5A_HUMAN
    • PIG54
    • SCC-112
    • SCC112
    • Sister chromatid cohesion protein 112
    • Sister chromatid cohesion protein PDS5 homolog A
    see all
  • Function
    Probable regulator of sister chromatid cohesion in mitosis which may stabilize cohesin complex association with chromatin. May couple sister chromatid cohesion during mitosis to DNA replication. Cohesion ensures that chromosome partitioning is accurate in both meiotic and mitotic cells and plays an important role in DNA repair.
  • Tissue specificity
    Highest level in colon. Low levels in lung, ovary, breast and kidney. Reduced level in renal tumor tissue. Isoform 2 is expressed in kidney.
  • Sequence similarities
    Belongs to the PDS5 family.
    Contains 1 HEAT repeat.
  • Developmental stage
    Cell cycle-regulated with highest level in G2 phase.
  • Cellular localization
    Nucleus. Associated with chromatin through most of the cell cycle. Dissociates from chromatin in late prophase, reassociates during late telophase.
  • Information by UniProt

Images

  • ab161580 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161580 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161580.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up