Recombinant human SCF protein (Active) (ab223003)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMV VQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLK KSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKD SRVSVTKPFMLPPVA
    • Molecular weight
      19 kDa
    • Amino acids
      26 to 189

Specifications

Our Abpromise guarantee covers the use of ab223003 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is less or equal to 10 ng/ml.

  • Applications

    SDS-PAGE

    Mass Spectrometry

    Functional Studies

  • Endotoxin level
    < 1.000 Eu/µg
  • Mass spectrometry
    MALDI-TOF
  • Purity
    >95% by SDS-PAGE .
    Purified by conventional column chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • C kit ligand
    • C-kit ligand
    • Ckit ligand
    • DCUA
    • DFNA69
    • DKFZp686F2250
    • familial progressive hyperpigmentation 2
    • FPH2
    • FPHH
    • KIT ligand
    • Kitl
    • KITLG
    • KL 1
    • KL1
    • Mast cell growth factor
    • MGF
    • MGF stem cell factor
    • SCF
    • SCF_HUMAN
    • SF
    • SHEP7
    • sKITLG
    • Soluble KIT ligand
    • Steel factor
    • steel, mouse, homolog of
    • Stem cell factor
    • Stem cell factor precursor
    see all
  • Function
    Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.
  • Involvement in disease
    Hyperpigmentation with or without hypopigmentation, familial progressive
    Deafness, congenital, unilateral or asymmetric
  • Sequence similarities
    Belongs to the SCF family.
  • Developmental stage
    Acts in the early stages of hematopoiesis.
  • Post-translational
    modifications
    A soluble form (sKITLG) is produced by proteolytic processing of isoform 1 in the extracellular domain.
    Found in two differentially glycosylated forms, LMW-SCF and HMW-SCF. LMW-SCF is fully N-glycosylated at Asn-145, partially N-glycosylated at Asn-90, O-glycosylated at Ser-167, Thr-168 and Thr-180, and not glycosylated at Asn-97 or Asn-118. HMW-SCF is N-glycosylated at Asn-118, Asn-90 and Asn-145, O-glycosylated at Ser-167, Thr-168 and Thr-180, and not glycosylated at Asn-97.
    A soluble form exists as a cleavage product of the extracellular domain.
  • Cellular localization
    Secreted; Cell membrane and Cytoplasm. Cytoplasm, cytoskeleton. Cell membrane. Cell projection, lamellipodium. Cell projection, filopodium.
  • Information by UniProt

Images

  • 3 µg of ab223003 analyzed by 15% SDS-PAGE.

References

ab223003 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223003.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up