Recombinant Human SCGB3A2 protein (ab151341)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      FLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCV NELGPEASEAVKKLLEALSHLV
    • Molecular weight
      8 kDa
    • Amino acids
      22 to 93

Specifications

Our Abpromise guarantee covers the use of ab151341 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Dissolve the lyophilized protein in 1X PBS.
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names
    • LU103
    • Pneumo secretory protein 1
    • PnSP-1
    • PNSP1
    • SCGB3A2
    • Secretoglobin family 3A member 2
    • SG3A2_HUMAN
    • UGRP1
    • Uteroglobin-related protein 1
    see all
  • Tissue specificity
    Highly expressed in lung.
  • Sequence similarities
    Belongs to the secretoglobin family. UGRP subfamily.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab151341 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151341.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up