Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO76038
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMDSSREPTLGRLDAAGFWQVWQRFDADEKG YIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQDASKDGRIRM KELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAEL RNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILAL QENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMM ELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP
    • Molecular weight34 kDa including tags
    • Amino acids1 to 276
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99417 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab99417 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Calbindin like
    • CALBL
    • DJ501N12.8
    • OTTHUMP00000016124
    • Scgn
    • SECRET
    • Secretagogin
    • Secretagogin EF hand calcium binding protein
    • SEGN
    • SEGN_HUMAN
    • Setagin
    see all
  • Tissue specificityExpressed at high levels in the pancreatic islets of Langerhans and to a much lesser extent in the gastrointestinal tract (stomach, small intestine and colon), the adrenal medulla and cortex and the thyroid C-cells. In the brain, the expression is restricted to distinct subtypes of neurons with highest expression in the molecular layer of the cerebellum (stellate and basket cells), in the anterior part of the pituitary gland, in the thalamus, in the hypothalamus and in a subgroup of neocortical neurons.
  • Sequence similaritiesContains 6 EF-hand domains.
  • Cellular localizationCytoplasm. Secreted. Cytoplasmic vesicle > secretory vesicle membrane. Predominantly cytoplasmic. A small proportion is associated with secretory granules and membrane fractions (By similarity). Detectable in human serum after ischemic neuronal damage.
  • Information by UniProt

Recombinant Human SCGN protein images

  • 15% SDS-PAGE showing ab99417 at approximately 34.2kDa (3µg).

References for Recombinant Human SCGN protein (ab99417)

ab99417 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99417.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"