Overview

  • Product name
    Recombinant Human SCML2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AKTESSPSEASQHSMQSPQKTTLILPTQQVRRSSRIKPPGPTAVPKRSSS VKNITPRKKGPNSGKKEKPLPVICSTSAASLKSLTRDRGMLYKDVASGPC
    • Amino acids
      251 to 350
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160971 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • SCML2
    • SCML2_HUMAN
    • Sex comb on midleg like 2
    • sex comb on midleg like 2 (Drosophila)
    • Sex comb on midleg like protein 2
    • Sex comb on midleg, Drosophila, homolog-like 2
    • Sex comb on midleg-like protein 2
    see all
  • Function
    Putative Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development.
  • Tissue specificity
    Highly expressed in placenta, thymus and testis. Detected at lower levels in brain, liver, skeletal muscle, pancreas and ovary.
  • Sequence similarities
    Belongs to the SCM family.
    Contains 2 MBT repeats.
    Contains 1 SAM (sterile alpha motif) domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab160971 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

This product has been referenced in:
  • Kosmidou C  et al. Issues with the Specificity of Immunological Reagents for NLRP3: Implications for Age-related Macular Degeneration. Sci Rep 8:461 (2018). Read more (PubMed: 29323137) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160971.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up