Recombinant Human SCN11A protein (ab161400)

Overview

  • Product name
    Recombinant Human SCN11A protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TTTKRKEEERGAAIIQKAFRKYMMKVTKGDQGDQNDLENGPHSPLQTLCN GDLSSFGVAKGKVHCD
    • Amino acids
      1726 to 1791
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161400 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hNaN
    • NaN
    • NAV1.9
    • Peripheral nerve sodium channel 5
    • PN 5
    • PN5
    • SCN 11A
    • SCN 12A
    • Scn11a
    • SCN12A
    • SCNBA_HUMAN
    • Sensory neuron sodium channel 2
    • SNS 2
    • SNS2
    • Sodium channel protein type 11 subunit alpha
    • Sodium channel protein type XI subunit alpha
    • Sodium channel voltage gated type XI alpha
    • Sodium channel voltage gated type XI alpha polypeptide
    • Sodium channel voltage gated type XI alpha subunit
    • Sodium channel voltage gated type XII alpha polypeptide
    • Voltage gated sodium channel Nav1.9
    • Voltage gated sodium channel subunit alpha Nav1.9
    • Voltage-gated sodium channel subunit alpha Nav1.9
    see all
  • Function
    This protein mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which sodium ions may pass in accordance with their electrochemical gradient. It is a tetrodotoxin-resistant sodium channel isoform. Also involved, with the contribution of the receptor tyrosine kinase NTRK2, in rapid BDNF-evoked neuronal depolarization.
  • Tissue specificity
    Expressed in the dorsal root ganglia and trigeminal ganglia, olfactory bulb, hippocampus, cerebellar cortex, spinal cord, spleen, small intestine and placenta.
  • Involvement in disease
    Neuropathy, hereditary sensory and autonomic, 7
    Episodic pain syndrome, familial, 3
  • Sequence similarities
    Belongs to the sodium channel (TC 1.A.1.10) family. Nav1.9/SCN11A subfamily.
  • Domain
    The sequence contains 4 internal repeats, each with 5 hydrophobic segments (S1,S2,S3,S5,S6) and one positively charged segment (S4). Segments S4 are probably the voltage-sensors and are characterized by a series of positively charged amino acids at every third position.
  • Post-translational
    modifications
    Phosphorylation at Ser-1341 by PKC in a highly conserved cytoplasmic loop slows inactivation of the sodium channel and reduces peak sodium currents.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab161400 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161400 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161400.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up