Overview

  • Product name
    Recombinant Human SCN1B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGRLLALVVGAALVSSACGGCVEVDSETEAVYGMTFKILCISCKRRSETN AETFTEWTFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKD LQDLSIFITNVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKA NRDMASIVSEIMMYVLIVVLTIWLVAEMIYCYKKIAAATETAAQENASEY LAITSESKENCTGVQVAE
    • Amino acids
      1 to 218
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159480 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GEFSP1
    • SCN1B
    • SCN1B_HUMAN
    • sodium channel beta 1 subunit
    • Sodium channel subunit beta 1
    • Sodium channel subunit beta-1
    • Sodium channel voltage gated type I beta
    • Sodium channel voltage gated type I beta subunit
    see all
  • Function
    Crucial in the assembly, expression, and functional modulation of the heterotrimeric complex of the sodium channel. The subunit beta-1 can modulate multiple alpha subunit isoforms from brain, skeletal muscle, and heart. Its association with neurofascin may target the sodium channels to the nodes of Ranvier of developing axons and retain these channels at the nodes in mature myelinated axons.
  • Tissue specificity
    Abundantly expressed in skeletal muscle, heart and brain.
  • Involvement in disease
    Defects in SCN1B are the cause of generalized epilepsy with febrile seizures plus type 1 (GEFS+1) [MIM:604233]. Generalized epilepsy with febrile seizures-plus refers to a rare autosomal dominant, familial condition with incomplete penetrance and large intrafamilial variability. Patients display febrile seizures persisting sometimes beyond the age of 6 years and/or a variety of afebrile seizure types. GEFS+ is a disease combining febrile seizures, generalized seizures often precipitated by fever at age 6 years or more, and partial seizures, with a variable degree of severity.
    Defects in SCN1B are the cause of Brugada syndrome type 5 (BRS5) [MIM:612838]. A tachyarrhythmia characterized by right bundle branch block and ST segment elevation on an electrocardiogram (ECG). It can cause the ventricles to beat so fast that the blood is prevented from circulating efficiently in the body. When this situation occurs (called ventricular fibrillation), the individual will faint and may die in a few minutes if the heart is not reset.
  • Sequence similarities
    Belongs to the sodium channel auxiliary subunit SCN1B (TC 8.A.17) family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab159480 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159480 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159480.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up