Overview

  • Product nameRecombinant Human Scn2b protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO60939
    • SpeciesHuman
    • SequenceMHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNVLNGSDARLPC TFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVE FSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEE PPERDSTVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEE EGKTDGEGNPDDGAK
    • Molecular weight50 kDa including tags
    • Amino acids1 to 215

Specifications

Our Abpromise guarantee covers the use of ab114773 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Neuronal voltage gated sodium channel beta 2 subunit
    • Scn 2b
    • Scn2b
    • SCN2B_HUMAN
    • Sodium channel beta 2 subunit
    • Sodium channel subunit beta 2
    • Sodium channel subunit beta-2
    • Sodium channel voltage gated type II beta
    • Sodium channel voltage gated type II beta polypeptide
    see all
  • FunctionCrucial in the assembly, expression, and functional modulation of the heterotrimeric complex of the sodium channel. The subunit beta-2 causes an increase in the plasma membrane surface area and in its folding into microvilli. Interacts with TNR may play a crucial role in clustering and regulation of activity of sodium channels at nodes of Ranvier.
  • Tissue specificityBrain specific.
  • Sequence similaritiesBelongs to the sodium channel auxiliary subunit SCN2B (TC 8.A.17) family.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human Scn2b protein images

  • ab114773 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Scn2b protein (ab114773)

ab114773 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114773.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"