Recombinant Human SCNN1D protein (ab159482)

Overview

  • Product name
    Recombinant Human SCNN1D protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      CFYRLYQDLETHRLPCTSRCPRPCRESAFKLSTGTSRWPSAKSAGWTLAT LGEQGLPHQSHRQRSSLAKINIVYQELNYRSVEEAPVYSVPQLLSAMGS
    • Amino acids
      432 to 530
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159482 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Amiloride sensitive sodium channel subunit delta
    • Amiloride-sensitive sodium channel subunit delta
    • Delta ENaC
    • Delta NaCH
    • Delta-ENaC
    • Delta-NaCH
    • DNACH
    • ENaC Delta
    • ENaCD
    • ENaCdelta
    • Epithelial Na(+) channel subunit delta
    • MGC149710
    • MGC149711
    • Nonvoltage gated sodium channel 1 subunit delta
    • Nonvoltage-gated sodium channel 1 subunit delta
    • SCNED
    • SCNN1D
    • SCNND_HUMAN
    • Sodium channel, nonvoltage gated 1, delta
    see all
  • Function
    Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception.
  • Sequence similarities
    Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1D subfamily.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab159482 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159482 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159482.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up