Overview

  • Product name
    Recombinant Human SCO2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGPAETGGQGQPQGPGLRTRLLITGLFGAG LGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFR GQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPE RDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDY IVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVLS
    • Molecular weight
      27 kDa including tags
    • Amino acids
      42 to 266
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103492 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab103492 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 30% Glycerol, 200mM Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • Cytochrome oxidase deficient homolog 2
    • MGC125823
    • MGC125825
    • OTTHUMP00000196774
    • OTTHUMP00000196775
    • Protein SCO2 homolog, mitochondrial
    • SCO (cytochrome oxidase deficient, yeast) homolog 2
    • SCO 1L
    • SCO 2
    • SCO cytochrome oxidase deficient homolog 2
    • SCO cytochrome oxidase deficient homolog 2 (yeast)
    • SCO1L
    • SCO2
    • SCO2_HUMAN
    • Synthesis of cytochrome c oxidase 2
    see all
  • Function
    Acts as a copper chaperone, transporting copper to the Cu(A) site on the cytochrome c oxidase subunit II (COX2).
  • Tissue specificity
    Ubiquitous.
  • Involvement in disease
    Defects in SCO2 are the cause of fatal infantile cardioencephalomyopathy with cytochrome c oxidase deficiency (FIC) [MIM:604377]. This disease is characterized by hypertrophic cardiomyopathy, lactic acidosis, and gliosis. Heart and skeletal muscle show reductions in cytochrome c oxidase (COX) activity, whereas liver and fibroblasts show mild COX deficiencies.
  • Sequence similarities
    Belongs to the SCO1/2 family.
    Contains 1 thioredoxin domain.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab103492.

References

ab103492 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab103492.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up