Overview

  • Product nameRecombinant Human SCO2 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO43819
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGPAETGGQGQPQGPGLRTRLLITGLFGAG LGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFR GQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPE RDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDY IVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVLS
    • Molecular weight27 kDa including tags
    • Amino acids42 to 266
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103492 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab103492 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 30% Glycerol, 200mM Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • Cytochrome oxidase deficient homolog 2
    • MGC125823
    • MGC125825
    • OTTHUMP00000196774
    • OTTHUMP00000196775
    • Protein SCO2 homolog, mitochondrial
    • SCO (cytochrome oxidase deficient, yeast) homolog 2
    • SCO 1L
    • SCO 2
    • SCO cytochrome oxidase deficient homolog 2
    • SCO cytochrome oxidase deficient homolog 2 (yeast)
    • SCO1L
    • SCO2
    • SCO2_HUMAN
    • Synthesis of cytochrome c oxidase 2
    see all
  • FunctionActs as a copper chaperone, transporting copper to the Cu(A) site on the cytochrome c oxidase subunit II (COX2).
  • Tissue specificityUbiquitous.
  • Involvement in diseaseDefects in SCO2 are the cause of fatal infantile cardioencephalomyopathy with cytochrome c oxidase deficiency (FIC) [MIM:604377]. This disease is characterized by hypertrophic cardiomyopathy, lactic acidosis, and gliosis. Heart and skeletal muscle show reductions in cytochrome c oxidase (COX) activity, whereas liver and fibroblasts show mild COX deficiencies.
  • Sequence similaritiesBelongs to the SCO1/2 family.
    Contains 1 thioredoxin domain.
  • Cellular localizationMitochondrion.
  • Information by UniProt

Recombinant Human SCO2 protein images

  • 15% SDS-PAGE analysis of 3µg ab103492.

References for Recombinant Human SCO2 protein (ab103492)

ab103492 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab103492.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"