Overview

  • Product name
    Recombinant Human SCO2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGPAETGGQGQPQGPGLRTRLLITGLFGAG LGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFR GQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPE RDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDY IVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSVLS
    • Molecular weight
      27 kDa including tags
    • Amino acids
      42 to 266
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103492 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab103492 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 30% Glycerol, 200mM Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • Cytochrome oxidase deficient homolog 2
    • MGC125823
    • MGC125825
    • OTTHUMP00000196774
    • OTTHUMP00000196775
    • Protein SCO2 homolog, mitochondrial
    • SCO (cytochrome oxidase deficient, yeast) homolog 2
    • SCO 1L
    • SCO 2
    • SCO cytochrome oxidase deficient homolog 2
    • SCO cytochrome oxidase deficient homolog 2 (yeast)
    • SCO1L
    • SCO2
    • SCO2_HUMAN
    • Synthesis of cytochrome c oxidase 2
    see all
  • Function
    Acts as a copper chaperone, transporting copper to the Cu(A) site on the cytochrome c oxidase subunit II (COX2).
  • Tissue specificity
    Ubiquitous.
  • Involvement in disease
    Defects in SCO2 are the cause of fatal infantile cardioencephalomyopathy with cytochrome c oxidase deficiency (FIC) [MIM:604377]. This disease is characterized by hypertrophic cardiomyopathy, lactic acidosis, and gliosis. Heart and skeletal muscle show reductions in cytochrome c oxidase (COX) activity, whereas liver and fibroblasts show mild COX deficiencies.
  • Sequence similarities
    Belongs to the SCO1/2 family.
    Contains 1 thioredoxin domain.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Recombinant Human SCO2 protein images

  • 15% SDS-PAGE analysis of 3µg ab103492.

References for Recombinant Human SCO2 protein (ab103492)

ab103492 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab103492.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up