Recombinant Human Scramblase 1 protein (ab114676)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP AGHSGPGPAGFPVPNQPVYNQPVYNQPVGAAGVPWMPAPQPPLNCPPGLE YLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCT RNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSCCCPCCLQEIEIQAPPG VPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCSCCGDVDFEIKSL DEQCVVGKISKHWTGILREAFTDADNFGIQFPLDLDVKMKAVMIGACFLI DFMFFESTGSQEQKSGVW
    • Molecular weight
      61 kDa including tags
    • Amino acids
      1 to 318

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114676 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ca(2+) dependent phospholipid scramblase 1
    • Ca(2+)-dependent phospholipid scramblase 1
    • Erythrocyte phospholipid scramblase
    • MM1 cell-derived transplantability-associated gene 1b, mouse, homolog of
    • MmTRA1a
    • MmTRA1b
    • Nor1
    • Phospholipid scramblase 1
    • PL scramblase 1
    • PLS1_HUMAN
    • PLSCR 1
    • Plscr1
    • Scramblase1
    • Tra1
    • Tra1a
    • Tra1b
    • Transplantability-associated protein 1
    • Tras1
    • Tras2
    see all
  • Function
    May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.
    May play a role in the antiviral response of interferon (IFN) by amplifying and enhancing the IFN response through increased expression of select subset of potent antiviral genes. May contribute to cytokine-regulated cell proliferation and differentiation.
  • Tissue specificity
    Expressed in platelets, erythrocyte membranes, lymphocytes, spleen, thymus, prostate, testis, uterus, intestine, colon, heart, placenta, lung, liver, kidney and pancreas. Not detected in brain and skeletal muscle.
  • Sequence similarities
    Belongs to the phospholipid scramblase family.
  • Post-translational
    modifications
    Known to be palmitoylated at one, yet undefined, site.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab114676 on a 12.5% gel stained with Coomassie Blue.

References

ab114676 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114676.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up