Recombinant Human Scramblase 1 protein (ab114676)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO15162
    • SpeciesHuman
    • SequenceMDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP AGHSGPGPAGFPVPNQPVYNQPVYNQPVGAAGVPWMPAPQPPLNCPPGLE YLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCT RNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSCCCPCCLQEIEIQAPPG VPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCSCCGDVDFEIKSL DEQCVVGKISKHWTGILREAFTDADNFGIQFPLDLDVKMKAVMIGACFLI DFMFFESTGSQEQKSGVW
    • Molecular weight61 kDa including tags
    • Amino acids1 to 318

Specifications

Our Abpromise guarantee covers the use of ab114676 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ca(2+) dependent phospholipid scramblase 1
    • Ca(2+)-dependent phospholipid scramblase 1
    • Erythrocyte phospholipid scramblase
    • MM1 cell-derived transplantability-associated gene 1b, mouse, homolog of
    • MmTRA1a
    • MmTRA1b
    • Nor1
    • Phospholipid scramblase 1
    • PL scramblase 1
    • PLS1_HUMAN
    • PLSCR 1
    • Plscr1
    • Scramblase1
    • Tra1
    • Tra1a
    • Tra1b
    • Transplantability-associated protein 1
    • Tras1
    • Tras2
    see all
  • FunctionMay mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.
    May play a role in the antiviral response of interferon (IFN) by amplifying and enhancing the IFN response through increased expression of select subset of potent antiviral genes. May contribute to cytokine-regulated cell proliferation and differentiation.
  • Tissue specificityExpressed in platelets, erythrocyte membranes, lymphocytes, spleen, thymus, prostate, testis, uterus, intestine, colon, heart, placenta, lung, liver, kidney and pancreas. Not detected in brain and skeletal muscle.
  • Sequence similaritiesBelongs to the phospholipid scramblase family.
  • Post-translational
    modifications
    Known to be palmitoylated at one, yet undefined, site.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human Scramblase 1 protein images

  • SDS-PAGE analysis of ab114676 on a 12.5% gel stained with Coomassie Blue.

References for Recombinant Human Scramblase 1 protein (ab114676)

ab114676 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114676.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"