Recombinant Human SCUBE3 protein (ab165997)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DVDECVEGTDNCHIDAICQNTPRSYKCICKSGYTGDGKHCKDVDECERED NAGCVHDCVNIPGNYRCTCYDGFHLAHDGHNCLDVDECAEGNGGCQQSCV NMMGSYECHCREGFFLSDN
    • Amino acids
      29 to 147
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165997 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CEGF3
    • CUB and EGF containing protein 3
    • CUB and EGF-like domain-containing protein 3
    • CUB domain and EGF like repeat containing 3
    • DKFZp686B09105
    • DKFZp686B1223
    • DKFZp686D20108
    • FLJ34743
    • OTTHUMP00000016250
    • SCUB3_HUMAN
    • SCUBE 3
    • SCUBE3
    • Signal peptide
    • Signal peptide CUB and EGF like domain containing protein 3
    • Signal peptide CUB domain EGF like 3
    see all
  • Tissue specificity
    Highly expressed in osteoblasts. Expression is low or absent in non-bone tissues.
  • Sequence similarities
    Contains 1 CUB domain.
    Contains 9 EGF-like domains.
  • Post-translational
    modifications
    N-glycosylated.
    May undergo proteolytic cleavage in the C-terminal region.
  • Cellular localization
    Secreted. Cell surface.
  • Information by UniProt

Images

  • ab165997 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165997 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165997.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up