Recombinant Human SCYL1BP1 protein (ab153571)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEP QRRLPAKKSRQQLQREKALVEQSQKLGLQDGSTSLLPEQLLSAPKQRVNV QKPPFSSPTLPSHFTLTSPVGDGQPQGIESQPKELGLENSHDGHNNVEIL PPKPDCKLEKKKVELQEKSRWEVLQQEQRLMEEKNKRKKALLAKAIAERS KRTQAETMKLKRIQKELQALDDMVSADIGILRNRIDQASLDYSYAR
    • Amino acids
      1 to 246
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153571 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ11752
    • GO
    • Golgin RAB6 interacting
    • GORAB
    • GORAB_HUMAN
    • hNTKL BP1
    • hNTKL-BP1
    • MGC51263
    • MGC70512
    • N terminal kinase like binding protein 1
    • N-terminal kinase-like-binding protein 1
    • NTKL binding protein 1
    • NTKL BP1
    • NTKL-binding protein 1
    • NTKL-BP1
    • NTKLBP 1
    • NTKLBP1
    • OTTHUMP00000033164
    • RAB6-interacting golgin
    • RP11 545I10.1
    • SCY1 like 1 binding protein 1
    • SCY1-like 1-binding protein 1
    • SCYL1 binding protein 1
    • SCYL1 BP1
    • SCYL1-binding protein 1
    • SCYL1-BP1
    • SCYL1BP1
    see all
  • Involvement in disease
    Defects in GORAB are the cause of geroderma osteodysplasticum (GO) [MIM:231070]; also known as gerodermia osteodysplastica or Walt Disney dwarfism. GO is a rare autosomal recessive disorder characterized by lax, wrinkled skin, joint laxity and a typical face with a prematurely aged appearance. Skeletal signs include severe osteoporosis leading to frequent fractures, malar and mandibular hypoplasia and a variable degree of growth retardation.
  • Sequence similarities
    Belongs to the GORAB family.
  • Cellular localization
    Cytoplasm. Golgi apparatus.
  • Information by UniProt

Images

  • ab153571 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153571 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153571.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up