Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ESMLNKLKSTVTKVTADVTSAVMGNPVTREFDVGRHIASGGNGLAWKIFN GTKKSTKQEVAVFVFDKKLIDKYQKFEKDQIIDSLKRGVQQLTRLRHPR
    • Amino acids
      2 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163176 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AU015688
    • AW536445
    • BC030932
    • Coated vesicle-associated kinase of 104 kDa
    • CVAK104
    • D10Ertd802e
    • FLJ10074
    • KIAA1360
    • RGD1305665
    • SCY1 like 2 (S. cerevisiae)
    • SCY1 like protein 2
    • SCY1-like protein 2
    • SCYL2
    • SCYL2_HUMAN
    see all
  • Function
    Component of AP2-containing clathrin coated structures at the plasma membrane or of endocytic coated vesicles. According to PubMed:15809293, probable serine/threonine-protein kinase that phosphorylates, in vitro, the beta2-subunit of the plasma membrane adapter complex AP2 and other proteins in presence of poly-L-lysine. According to PubMed:16914521, has no detectable kinase activity in vitro. May regulate clathrin-dependent trafficking between the TGN and/or the endosomal system.
  • Sequence similarities
    Belongs to the protein kinase superfamily.
    Contains 1 HEAT repeat.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    According to PubMed:15809293, autophosphorylated in presence of poly-L-lysine.
  • Cellular localization
    Cytoplasm > perinuclear region. Cytoplasmic vesicle > clathrin-coated vesicle. Golgi apparatus > trans-Golgi network membrane. Endosome membrane. According to PubMed:15809293, plasma membrane-associated in clathrin-coated vesicles. According to PubMed:16914521, colocalizes to the trans-Golgi network (TGN) and to endosomal membranes with clathrin, transferrin and plasma membrane adapter AP1 and AP3 complexes.
  • Information by UniProt

Images

  • ab163176 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163176 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163176.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up