Overview

  • Product name
    Recombinant Human SDF4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVWPWVAMASRWGPLIGLAPCCLWLLGAVLLMDASARPANHSSTRERVAN REENEILPPDHLNGVKLEMDGHLNRGFHQEVFLGKDLGGFDEDAEPRRSR RKLMVIFSKVDVNTDRKISAKEMQRWIMEKTAEHFQEAMEESKTHFRAVD PDGDGHVSWDEYKVKFLASKGHSEKEVADAIRLNEELKVDEETQEVLENL KDRWYQADSPPADLLLTEEEFLSFLHPEHSRGMLRFMVKEIVRDLDQDGD KQLSVPEFISLPVGTVENQQGQDIDDNWVKDRKKEFEELIDSNHDGIVTA EELESYMDPMNEYNALNEAKQMIAVADENQNHHLEPEEVLKYSEFFTGSK LVDYARSVHEEF
    • Amino acids
      1 to 362
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162434 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 45 kDa calcium-binding protein
    • Cab45
    • CAB45_HUMAN
    • Calcium binding protein
    • PSEC0034
    • SDF 4
    • SDF-4
    • SDF4
    • Stromal cell derived factor 4
    • Stromal cell-derived factor 4
    see all
  • Function
    May regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment.
    Isoform 5 may be involved in the exocytosis of zymogens by pancreatic acini.
  • Tissue specificity
    Ubiquitous. Isoform 5 is expressed in pancreas.
  • Sequence similarities
    Belongs to the CREC family.
    Contains 6 EF-hand domains.
  • Cellular localization
    Golgi apparatus lumen and Cytoplasm. Cell projection > bleb. Isoform 5 colocalizes with STX3 and STXBP1 isoform 2 at the plasma membrane and cell surface blebs.
  • Information by UniProt

Images

  • ab162434 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162434 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162434.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up