Overview

  • Product name
    Recombinant Human SDHC protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNR PLSPHITIYSWSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYL ELVKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLKIPQLYQ SGVVVLVLTVLSSMGLAAM
    • Amino acids
      1 to 169
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159493 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CYB560
    • C560_HUMAN
    • CYBL
    • Cytochrome B large subunit of complex II
    • Integral membrane protein CII-3
    • mitochondrial
    • PGL3
    • QPs-1
    • QPs1
    • SDH3
    • sdhC
    • succinate dehydrgenase cytochrome b
    • succinate dehydrogenase 3, integral membrane subunit
    • Succinate dehydrogenase complex subunit C
    • Succinate dehydrogenase complex subunit C integral membrane protein 15kDa
    • Succinate dehydrogenase cytochrome b560 subunit
    • Succinate dehydrogenase cytochrome b560 subunit mitochondrial
    • Succinate dehydrogenase cytochrome b560 subunit, mitochondrial precursor
    • Succinate-ubiquinone oxidoreductase cytochrome B large subunit
    see all
  • Function
    Membrane-anchoring subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).
  • Pathway
    Carbohydrate metabolism; tricarboxylic acid cycle.
  • Involvement in disease
    Defects in SDHC are the cause of hereditary paragangliomas type 3 (PGL3) [MIM:605373]; also known as autosomal dominant non-chromaffin paragangliomas type 3. Non-chromaffin paragangliomas are usually benign, neural crest derived tumors of parasympathetic ganglia.
    Defects in SDHC are a cause of paraganglioma and gastric stromal sarcoma (PGGSS) [MIM:606864]; also known as Carney-Stratakis syndrome. Gastrointestinal stromal tumors may be sporadic or inherited in an autosomal dominant manner, alone or as a component of a syndrome associated with other tumors, such as in the context of neurofibromatosis type 1 (NF1). Patients have both gastrointestinal stromal tumors and paragangliomas. Susceptibility to the tumors was inherited in an apparently autosomal dominant manner, with incomplete penetrance.
  • Sequence similarities
    Belongs to the cytochrome b560 family.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab159493 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159493 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159493.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up