Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EHLPATPAESPAQRFEARIEDGKLYYDKRWYHKSQAIYLESKDNQKLSCV ISSVGANEIWVRKTSDSTKMRIYLGQLQRGLFVIRRRSAA
    • Amino acids
      80 to 169
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153488 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2400003N08Rik
    • 2410008L21Rik
    • 45 kDa Sin3 associated polypeptide
    • 45 kDa Sin3-associated polypeptide
    • AU067672
    • FLJ00052
    • MGC104711
    • mSds3
    • RGD1305986
    • SAP45
    • SDS3
    • SDS3, yeast, homolog of
    • SDS3_HUMAN
    • Sin3 histone deacetylase corepressor complex component SDS3
    • Sin3A associated protein 45kDa
    • Suds3
    • Suppressor of defective silencing 3
    • Suppressor of defective silencing 3 homolog (S cerevisiae)
    • Suppressor of defective silencing 3 homolog (SDS3 S cerevisiae)
    • Suppressor of defective silencing 3 protein homolog
    see all
  • Function
    Regulatory protein which represses transcription and augments histone deacetylase activity of HDAC1. May have a potential role in tumor suppressor pathways (By similarity). May function in the assembly and/or enzymatic activity of the mSin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes.
  • Tissue specificity
    Expressed in various cancer cell ines.
  • Sequence similarities
    Belongs to the SDS3 family.
  • Domain
    The C-terminus is involved in transcriptional repression by HDAC-independent mechanisms.
  • Information by UniProt

Images

  • ab153488 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153488 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153488.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up