Recombinant Human SEC14 like protein 2 (ab161677)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSGRVGDLSPRQKEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQ KSEAMLRKHVEFRKQKDIDNIISWQPPEVIQQYLSGGMCGYDLDGCPVWY DIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETIT IIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPV AYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVPVEYGGTMTDPDG NPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPG CVLRWQFMSDGADVGFGIFLKTKMGERQRAGEMTEVLPNQRYNSHLVPED GTLTCSDPGICKYLCLGNALKPHVQLSACEVPLPPWIFGSEC
    • Amino acids
      1 to 392
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161677 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Alpha tocopherol associated protein
    • Alpha-tocopherol-associated protein
    • C22orf6
    • hTAP
    • KIAA1186
    • KIAA1658
    • MGC65053
    • OTTHUMP00000198972
    • OTTHUMP00000198973
    • OTTHUMP00000198974
    • OTTHUMP00000199021
    • S14L2_HUMAN
    • SEC14 (S. cerevisiae) like 2
    • SEC14 like 2 (S. cerevisiae)
    • SEC14 like protein 2
    • SEC14-like protein 2
    • Sec14l2
    • SPF
    • Squalene transfer protein
    • Supernatant protein factor
    • TAP
    • TAP1
    • tocopherol-associated protein
    see all
  • Function
    Carrier protein. Binds to some hydrophobic molecules and promotes their transfer between the different cellular sites. Binds with high affinity to alpha-tocopherol. Also binds with a weaker affinity to other tocopherols and to tocotrienols. May have a transcriptional activatory activity via its association with alpha-tocopherol. Probably recognizes and binds some squalene structure, suggesting that it may regulate cholesterol biosynthesis by increasing the transfer of squalene to a metabolic active pool in the cell.
  • Tissue specificity
    Widely expressed. Strong expression in liver, brain and prostate.
  • Sequence similarities
    Contains 1 CRAL-TRIO domain.
    Contains 1 GOLD domain.
  • Developmental stage
    Low expression in fetal tissues.
  • Cellular localization
    Cytoplasm. Nucleus. Cytoplasmic in absence of alpha-tocopherol, and nuclear in presence of alpha-tocopherol.
  • Information by UniProt

Images

  • ab161677 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161677 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161677.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up