Recombinant Human SEC14L4 protein (ab166189)

Overview

  • Product name
    Recombinant Human SEC14L4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLRRHMEFRKQQDLDNIVTWQPPEVIQLYDSGGLCGYDYEGCPVYFNIIG SLDPKGLLLSASKQDMIRKRIKVCELLLHECELQTQKLGRKIEMALMVFD MEGLSLKHLWKPAVEVYQQFFSILEANYPETLKNLIVIRAPKLFPVAFNL VKSFMSEETRRKIVILGDNWKQELTKFISPDQLPVEFGGTMTDPDGNPKC LTKINYGGEVPKSYYLCEQVRLQYEHTRSVGRGSSLQVENEILFPGCVLR WQFASDGGDIGFGVFLKTKMGEQQSAREMTEVLPSQRYNAHMVPEDGSLT CLQAGVYVLRFDNTYSRMHAKKLSYTVEVLLPDKASEETLQSLKAMRPSP TQ
    • Amino acids
      1 to 352
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166189 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI256582
    • AW536553
    • dJ130H16
    • MGC30313
    • RGD1565810
    • S14L4_HUMAN
    • SEC14, S. cerevisiae, homolog of, 4
    • SEC14-like 4
    • SEC14-like 4 (S. cerevisiae)
    • SEC14-like protein 4
    • Sec14l4
    • SEC14p-like protein TAP3
    • SPF
    • TAP
    • TAP3
    • Tocopherol-associated protein 3
    see all
  • Function
    Probable hydrophobic ligand-binding protein; may play a role in the transport of hydrophobic ligands like tocopherol, squalene and phospholipids.
  • Sequence similarities
    Contains 1 CRAL-TRIO domain.
    Contains 1 GOLD domain.
  • Information by UniProt

Images

  • ab166189 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166189 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166189.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up