Recombinant Human SEC22C protein (ab160345)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VIFFACVVRVRDGLPLSASTDFYHTQDFLEWRRRLKSLALRLAQYPGRGS AEGCDFSIHFSSFGDV
    • Amino acids
      3 to 68
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160345 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp761F2321
    • MGC13261
    • MGC5373
    • OTTHUMP00000162608
    • SEC22 homolog C, vesicle trafficking protein
    • SEC22 vesicle trafficking protein homolog C
    • SEC22 vesicle trafficking protein homolog C (S. cerevisiae)
    • SEC22 vesicle trafficking protein like 3
    • SEC22 vesicle trafficking protein like 3 (S. cerevisiae)
    • SEC22 vesicle trafficking protein like protein C
    • SEC22L3
    • secretion deficient 22C
    • vesicle trafficking protein
    • Vesicle trafficking protein SEC22c
    see all
  • Relevance
    The protein encoded by this gene is a member of the SEC22 family of vesicle trafficking proteins. It is localized at the endoplasmic reticulum and it is thought to play a role in the early stages of the ER-Golgi protein trafficking. There are two alternatively spliced transcript variants encoding different isoforms described for this gene.
  • Cellular localization
    Endoplasmic reticulum membrane; Multi-pass membrane protein

Images

  • ab160345 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160345 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160345.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up