Recombinant Human SEC22L2 protein (ab162047)

Overview

  • Product name
    Recombinant Human SEC22L2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSMILSASVIRVRDGLPLSASTDYEQSTGMQECRKYFKMLSRKLAQLPDR CTLKTGHYNINFISSLGVSYMMLCTENYPNVLAFSFLDELQKEFITTYNM MKTNTAVRPYCFIEFDNFIQRTKQRYNNPRSLSTKINLSDMQTEIKLRPP YQISMCELGSANGVTSAFSVDCKGAGKISSAHQRLEPATLSGIVGFILSL LCGALNLIRGFHAIESLLQSDGDDFNYIIAFFLGTAACLYQCYLLVYYTG WRNVKSFLTFGLICLCNMYLYELRNLWQLFFHVTVGAFVTLQIWLRQAQG KAPDYDV
    • Amino acids
      1 to 307
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162047 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • SEC22 vesicle trafficking protein homolog A (S. cerevisiae)
    • SEC22 vesicle trafficking protein like 2
    • SEC22L2
    • Vesicle trafficking protein SEC22a
  • Relevance
    SEC22L2 belongs to the member of the SEC22 family of vesicle trafficking proteins. This protein has similarity to rat SEC22 and may act in the early stages of the secretory pathway. There is evidence for the use of multiple poly A sites in this gene.
  • Cellular localization
    Endoplasmic reticulum membrane; Multi-pass membrane protein.

Images

  • ab162047 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162047 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162047.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up