Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTTYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPVAALFTPLKERPD LPPIQYEPVLCSRTTCRAVLNPLCQVDYRAKLWACNFCYQRNQFPPSYAG ISELNQPAELLPQFSSIEYVVLRGPQMPLIFLYVVDTCMEDEDLQALKES MQMSLSLLPPTALVGLITFGRMVQVHELGCEGISKSYVFRGTKDLSAKQL QEMLGLSKVPVTQATRGPQVQQPPPSNRFLQPVQKIDMNLTDLLGELQRD PWPVPQGKRPLRSSGVALSIAVGLLECTFPNTGARIMMFIGGPATQGPGM VVGDELKTPIRSWHDIDKDNAKYVKKGTKHFEALANRAATTGHVIDIYAC ALDQTGLLEMKCCPNLTGGYMVMGDSFNTSLFKQTFQRVFTKDMHGQFKM GFGGTLEIKTSREIKISGAIGPCVSLNSKGPCVSENEIGTGGTCQWKICG LSPTTTLAIYFEVVNQHNAPIPQGGRGAIQFVTQYQHSSGQRRIRVTTIA RNWADAQTQIQNIAASFDQEAAAILMARLAIYRAETEEGPDVLRWLDRQL IRLCQKFGEYHKDDPSSFRFSETFSLYPQFMFHLRRSSFLQVFNNSPDES SYYRHHFMRQDLTQSLIMIQPIMYAYSFSGPPEPVLLDSSSILADRILLM DTFFQILIYHGETIAQWRKSGYQDMPEYENFRHLLQAPVDDAQEILHSRF PMPRYIDTEHGGSQARFLLSKVNPSQTHNNMYAWGQESGAPILTDDVSLQ VFMDHLKKLAVSSAA
    • Amino acids
      1 to 765
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161014 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CLSD
    • Protein transport protein Sec23A
    • SC23A_HUMAN
    • Sec23 homolog A (S. cerevisiae)
    • SEC23-related protein A
    • sec23a
    see all
  • Function
    Component of the COPII coat, that covers ER-derived vesicles involved in transport from the endoplasmic reticulum to the Golgi apparatus. COPII acts in the cytoplasm to promote the transport of secretory, plasma membrane, and vacuolar proteins from the endoplasmic reticulum to the Golgi complex.
  • Involvement in disease
    Defects in SEC23A are the cause of craniolenticulosutural dysplasia (CLSD) [MIM:607812]; also known as cranio-lenticulo-sutural dysplasia. CLSD is an autosomal recessive syndrome characterized by late-closing fontanels, sutural cataracts, facial dysmorphisms and skeletal defects.
  • Sequence similarities
    Belongs to the SEC23/SEC24 family. SEC23 subfamily.
  • Cellular localization
    Smooth endoplasmic reticulum membrane. Golgi apparatus membrane. In the ribosome-free transitional face of the ER and associated vesicles.
  • Information by UniProt

Images

  • ab161014 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161014 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161014.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up