Recombinant Human SEC23B protein (ab161013)

Overview

  • Product name
    Recombinant Human SEC23B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MATYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPD LPPVQYEPVLCSRPTCKAVLNPLCQVDYRAKLWACNFCFQRNQFPPAYGG ISEVNQPAELMPQFSTIEYVIQRGAQSPLIFLYVVDTCLEEDDLQALKES LQMSLSLLPPDALVGLITFGRMVQVHELSCEGISKSYVFRGTKDLTAKQI QDMLGLTKPAMPMQQARPAQPQEHPFASSRFLQPVHKIDMNLTDLLGELQ RDPWPVTQGKRPLRSTGVALSIAVGLLEGTFPNTGARIMLFTGGPPTQGP GMVVGDELKIPIRSWHDIEKDNARFMKKATKHYEMLANRTAANGHCIDIY ACALDQTGLLEMKCCANLTGGYVVMGDSFNTSLFKQTFQRIFTKDFNGDF RMAFGATLDVKTSRELKIAGAIGPCVSLNVKGLCVSENELGVGGTSQWKI CGLDPTSTLGIYFEVVNQHNTPIPQGGRGAIQFVTHYQHSSTQRRIRVTT IARNWADVQSQLRHIEAAFDQEAAAVLMARLGVFRAESEEGPDVLRWLDR QLIRLCQKFGQYNKEDPTSFRLSDSFSLYPQFMFHLRRSPFLQVFNNSPD ESSYYRHHFARQDLTQSLIMIQPILYSYSFHGPPEPVLLDSSSILADRIL LMDTFFQIVIYLGETIAQWRKAGYQDMPEYENFKHLLQAPLDDAQEILQA RFPMPRYINTEHGGSQARFLLSKVNPSQTHNNLYAWGQETGAPILTDDVS LQVFMDHLKKLAVSSAC
    • Amino acids
      1 to 767
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161013 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CDA II
    • CDAII
    • CDAN2
    • HEMPAS
    • Protein transport protein Sec23B
    • RP11-379J5.1
    • SC23B_HUMAN
    • Sec23 homolog B (S. cerevisiae)
    • SEC23 related protein B
    • SEC23-like protein B
    • SEC23-related protein B
    • Sec23b
    • Transport protein SEC23B
    see all
  • Function
    Component of the COPII coat, that covers ER-derived vesicles involved in transport from the endoplasmic reticulum to the Golgi apparatus. COPII acts in the cytoplasm to promote the transport of secretory, plasma membrane, and vacuolar proteins from the endoplasmic reticulum to the Golgi complex.
  • Involvement in disease
    Defects in SEC23B are the cause of congenital dyserythropoietic anemia type 2 (CDA2) [MIM:224100]. An autosomal recessive blood disorder characterized by morphological abnormalities of erythroblasts, ineffective erythropoiesis, normocytic anemia, iron overload, jaundice, and variable splenomegaly. Ultrastructural features include bi- or multinucleated erythroblasts in bone marrow, karyorrhexis, and the presence of Gaucher-like bone marrow histiocytes. The main biochemical feature of the disease is defective glycosylation of some red blood cells membrane proteins.
  • Sequence similarities
    Belongs to the SEC23/SEC24 family. SEC23 subfamily.
  • Cellular localization
    Golgi apparatus membrane. Endoplasmic reticulum membrane. Endoplasmic reticulum-Golgi intermediate compartment membrane.
  • Information by UniProt

Images

  • ab161013 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161013 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161013.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up